PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo23G0015500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family GRAS
Protein Properties Length: 753aa    MW: 83924.5 Da    PI: 6.1279
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo23G0015500genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS382.35.9e-1173757461374
             GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                      l++lL++cA+av+++d + a +lL+++++++sp gd +qRla++f+ +L+arla+++s++y+al ++++s    +  l+a++l+  ++P+ ++s
  Spipo23G0015500 375 LRTLLVHCAQAVAADDRRSAGELLKQIRQHSSPWGDGTQRLAHCFADGLEARLAGTGSQMYNALMAKRQS---ATAILKAYHLYLAACPFKRVS 465
                      6789************************************************************999998...899****************** PP

             GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrl 186
                      h+ aNq+I++ +e+++++HiiDf+i  G+QWp+L+q L++Rp+gpp+lRiTg++ p++g   +e++eetg+rL+++A++++v++e+ + +  ++
  Spipo23G0015500 466 HFFANQTIYNIAEKAKKLHIIDFGIYFGFQWPCLIQRLSTRPGGPPKLRITGIDVPQPGfrPNERIEETGRRLEEYARKFNVELEYFP-IGAKW 558
                      **********************************************************9*****************************.799** PP

             GRAS 187 edleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklprese 280
                      e++++e+Lr++p+E+l+Vn++++  +l de+v ++s+r++vL+ +++++P v+++   +   +++ F++rf eal ++salfd+lea++pr++ 
  Spipo23G0015500 559 EAIRVEDLRIDPEEVLVVNCMYRFRNLIDETVVVDSPRNTVLNNIRKMNPAVFIHGVVNGAFSAPFFVTRFREALFHFSALFDMLEATVPRDHP 652
                      ********************************************************************************************** PP

             GRAS 281 erikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                      er  +Ere++gr+++nv+aceg+er+er et+++W+ r  +aGF ++pl+  ++k  +  +r ++++ + ++e+s++l++gWk+r ++++S W+
  Spipo23G0015500 653 ERLLIEREIFGRDAMNVIACEGSERVERPETYKQWQVRNLRAGFAQLPLDPGIMKRCRDKVRSIYDKDFVIDEDSQWLLQGWKGRIIYAISTWK 746
                      *****************************************************************999*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098567.803349726IPR005202Transcription factor GRAS
PfamPF035142.0E-114375746IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 753 aa     Download sequence    Send to blast
MTSRALSAVE PVVAESALQQ PAGDADSFNP DDPDSSVDHS SFGDDQSFIL VAASDGHPAP  60
PVSSYPRGDS PEDSEIFSDI ALTYISKMLM EEDMDEKVII YREGAALQAA EKPFYDILGE  120
KYPPPPGQHS SDSPEDSGSS SQHGNSVSSV VNNGCFHDFG EQPSPQIGGF SVSHSSRSSS  180
SSFSPSNGIA SVLDRIRDPQ SSETGRRADD LLVESQPARS FRRGVEEASK FLPDRKKLVI  240
DLESNGFSLL DDRAKVGQID PVDVKVEKEE RGMIPASSKN RKNPHQEDLY LEEGRSVKQS  300
AISSEDDVVR SEMFDMVLLC NQGKPNDAVT SLREALLNEV SKSNPPKNGG QSKGASNNGG  360
KSRGKRQVKK EVVDLRTLLV HCAQAVAADD RRSAGELLKQ IRQHSSPWGD GTQRLAHCFA  420
DGLEARLAGT GSQMYNALMA KRQSATAILK AYHLYLAACP FKRVSHFFAN QTIYNIAEKA  480
KKLHIIDFGI YFGFQWPCLI QRLSTRPGGP PKLRITGIDV PQPGFRPNER IEETGRRLEE  540
YARKFNVELE YFPIGAKWEA IRVEDLRIDP EEVLVVNCMY RFRNLIDETV VVDSPRNTVL  600
NNIRKMNPAV FIHGVVNGAF SAPFFVTRFR EALFHFSALF DMLEATVPRD HPERLLIERE  660
IFGRDAMNVI ACEGSERVER PETYKQWQVR NLRAGFAQLP LDPGIMKRCR DKVRSIYDKD  720
FVIDEDSQWL LQGWKGRIIY AISTWKPDVL RL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-513797468375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010920560.10.0PREDICTED: scarecrow-like protein 9
RefseqXP_010920559.10.0PREDICTED: scarecrow-like protein 9
RefseqXP_010920558.10.0PREDICTED: scarecrow-like protein 9
RefseqXP_010920557.10.0PREDICTED: scarecrow-like protein 9
RefseqXP_010920556.10.0PREDICTED: scarecrow-like protein 9
RefseqXP_010920554.10.0PREDICTED: scarecrow-like protein 9
TrEMBLM5W3W50.0M5W3W5_PRUPE; Uncharacterized protein
STRINGOB03G37330.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP150538118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.10.0GRAS family protein